Loading...
Statistics
Advertisement

Abandon Perfection
www.abandon-perfection.com/

Abandon-perfection.com

Advertisement
Abandon-perfection.com is hosted in United States / New York . Abandon-perfection.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: Site-bundle.js, Number of used analytics tools: 0. Its server type is: . Its CMS is: Squarespace.

Technologies in use by Abandon-perfection.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • Lightbox
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 1
  • site-bundle.js

Content Management System

Number of occurences: 1
  • Squarespace

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Abandon-perfection.com

SSL certificate

    • name: /C=US/ST=New York/L=New York/O=Squarespace, Inc./OU=Web Services/CN=*.squarespace.com
    • subject:
      • C: US
      • ST: New York
      • L: New York
      • O: Squarespace, Inc.
      • OU: Web Services
      • CN: *.squarespace.com
    • hash: 0420e8ec
    • issuer:
      • C: US
      • O: DigiCert Inc
      • OU: www.digicert.com
      • CN: DigiCert SHA2 High Assurance Server CA
    • version: 2
    • serialNumber: 5424579060044022025581262814810671247
    • validFrom: 140409000000Z
    • validTo: 170612120000Z
    • validFrom_time_t: 1397001600
    • validTo_time_t: 1497268800
    • extensions:
      • authorityKeyIdentifier: keyid:51:68:FF:90:AF:02:07:75:3C:CC:D9:65:64:62:A2:12:B8:59:72:3B
      • subjectKeyIdentifier: 66:00:FC:DC:5D:A9:05:68:C4:F7:7A:45:5B:F0:B0:72:B9:F6:E1:E6
      • subjectAltName: DNS:*.squarespace.com, DNS:squarespace.com
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl3.digicert.com/sha2-ha-server-g1.crl Full Name: URI:http://crl4.digicert.com/sha2-ha-server-g1.crl
      • certificatePolicies: Policy: 2.16.840.1.114412.1.1 CPS: https://www.digicert.com/CPS
      • authorityInfoAccess: OCSP - URI:http://ocsp.digicert.com CA Issuers - URI:http://cacerts.digicert.com/DigiCertSHA2HighAssuranceServerCA.crt
      • basicConstraints: CA:FALSE

Meta - Abandon-perfection.com

Number of occurences: 6
  • Name:
    Content: http://www.abandon-perfection.com/
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: twitter:title
    Content: Home
  • Name: twitter:url
    Content: http://www.abandon-perfection.com/
  • Name: twitter:card
    Content: summary
  • Name: description
    Content:

Server / Hosting

  • IP: 198.49.23.145
  • Latitude: 40.72
  • Longitude: -74.01
  • Country: United States
  • City: New York

Rname

  • ns2.hover.com
  • ns1.hover.com
  • mx.hover.com.cust.hostedemail.com

Target

  • dnsmaster.hover.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sun, 19 Jun 2016 12:02:12 GMT X-ServedBy: web116 Location: http://www.abandon-perfection.com/ X-ContextId: 6RhOyQmQ/nHRWGobl X-Via: 1.1 echo019 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 OK Date: Sun, 19 Jun 2016 12:02:12 GMT X-ServedBy: web133 Set-Cookie: crumb=AT5MepUFel7pHIMX4IazTbERgpZWpml5;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Set-Cookie: SS_MID=92387346-d7c6-44ee-ad5c-73d06457a112ipmjmjh4;Path=/;Domain=.abandon-perfection.com;Expires=Wed, 17-Jun-2026 12:02:12 GMT Accept-Ranges: bytes Content-Type: text/html; charset=UTF-8 X-PC-AppVer: 8102 X-PC-Date: Sun, 19 Jun 2016 12:02:08 GMT X-PC-Host: 10.120.201.127 ETag: W/"7d33d9dc5c9cd5b440e4f23891a27fb3" X-PC-Key: oO_c39cqN6C8ItQ7eNRnraN04us-carissa-shaul X-PC-Hit: true X-ContextId: CokiP0iP/1WK6eztU X-Via: 1.1 echo017 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

DNS

host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 198.49.23.145
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 198.49.23.144
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 198.185.159.144
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: A
  4. ip: 198.185.159.145
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns2.hover.com
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: NS
  4. target: ns1.hover.com
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: SOA
  4. mname: ns1.hover.com
  5. rname: dnsmaster.hover.com
  6. serial: 1430970712
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 900
host: abandon-perfection.com
  1. class: IN
  2. ttl: 900
  3. type: MX
  4. pri: 10
  5. target: mx.hover.com.cust.hostedemail.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.bandon-perfection.com, www.aobandon-perfection.com, www.obandon-perfection.com, www.apbandon-perfection.com, www.pbandon-perfection.com, www.a9bandon-perfection.com, www.9bandon-perfection.com, www.abandon-perfection.com, www.bandon-perfection.com, www.aibandon-perfection.com, www.ibandon-perfection.com, www.aubandon-perfection.com, www.ubandon-perfection.com, www.aandon-perfection.com, www.abqandon-perfection.com, www.aqandon-perfection.com, www.abwandon-perfection.com, www.awandon-perfection.com, www.abzandon-perfection.com, www.azandon-perfection.com, www.abxandon-perfection.com, www.axandon-perfection.com, www.abandon-perfection.com, www.aandon-perfection.com, www.absandon-perfection.com, www.asandon-perfection.com, www.abyandon-perfection.com, www.ayandon-perfection.com, www.abeandon-perfection.com, www.aeandon-perfection.com, www.abdandon-perfection.com, www.adandon-perfection.com, www.abcandon-perfection.com, www.acandon-perfection.com, www.abndon-perfection.com, www.abaondon-perfection.com, www.abondon-perfection.com, www.abapndon-perfection.com, www.abpndon-perfection.com, www.aba9ndon-perfection.com, www.ab9ndon-perfection.com, www.abandon-perfection.com, www.abndon-perfection.com, www.abaindon-perfection.com, www.abindon-perfection.com, www.abaundon-perfection.com, www.abundon-perfection.com, www.abadon-perfection.com, www.abanndon-perfection.com, www.abandon-perfection.com, www.abanhdon-perfection.com, www.abahdon-perfection.com, www.abanjdon-perfection.com, www.abajdon-perfection.com, www.abankdon-perfection.com, www.abakdon-perfection.com, www.abanldon-perfection.com, www.abaldon-perfection.com, www.aban don-perfection.com, www.aba don-perfection.com, www.abanon-perfection.com, www.abandton-perfection.com, www.abanton-perfection.com, www.abandgon-perfection.com, www.abandbon-perfection.com, www.abanbon-perfection.com, www.abandxon-perfection.com, www.abanxon-perfection.com, www.abandson-perfection.com, www.abanson-perfection.com, www.abandfon-perfection.com, www.abanfon-perfection.com, www.abandvon-perfection.com, www.abanvon-perfection.com, www.abandyon-perfection.com, www.abanyon-perfection.com, www.abandzon-perfection.com, www.abanzon-perfection.com, www.abandaon-perfection.com, www.abanaon-perfection.com, www.abandeon-perfection.com, www.abaneon-perfection.com, www.abandron-perfection.com, www.abanron-perfection.com, www.abandn-perfection.com, www.abandobn-perfection.com, www.abandbn-perfection.com, www.abandohn-perfection.com, www.abandhn-perfection.com, www.abandogn-perfection.com, www.abandgn-perfection.com, www.abandojn-perfection.com, www.abandjn-perfection.com, www.abandomn-perfection.com, www.abandmn-perfection.com, www.abando n-perfection.com, www.aband n-perfection.com, www.abandovn-perfection.com, www.abandvn-perfection.com, www.abando-perfection.com, www.abandonn-perfection.com, www.abandon-perfection.com, www.abandonh-perfection.com, www.abandoh-perfection.com, www.abandonj-perfection.com, www.abandoj-perfection.com, www.abandonk-perfection.com, www.abandok-perfection.com, www.abandonl-perfection.com, www.abandol-perfection.com, www.abandon -perfection.com, www.abando -perfection.com, www.abandonperfection.com, www.abandon-tperfection.com, www.abandontperfection.com, www.abandon-gperfection.com, www.abandongperfection.com, www.abandon-hperfection.com, www.abandonhperfection.com, www.abandon-uperfection.com, www.abandonuperfection.com, www.abandon-jperfection.com, www.abandonjperfection.com, www.abandon-xperfection.com, www.abandonxperfection.com, www.abandon-sperfection.com, www.abandonsperfection.com, www.abandon-aperfection.com, www.abandonaperfection.com, www.abandon-perfection.com, www.abandonperfection.com, www.abandon- perfection.com, www.abandon perfection.com, www.abandon-erfection.com, www.abandon-pierfection.com, www.abandon-ierfection.com, www.abandon-pkerfection.com, www.abandon-kerfection.com, www.abandon-puerfection.com, www.abandon-uerfection.com, www.abandon-pjerfection.com, www.abandon-jerfection.com, www.abandon-plerfection.com, www.abandon-lerfection.com, www.abandon-prfection.com, www.abandon-pexrfection.com, www.abandon-pxrfection.com, www.abandon-pesrfection.com, www.abandon-psrfection.com, www.abandon-pewrfection.com, www.abandon-pwrfection.com, www.abandon-perrfection.com, www.abandon-prrfection.com, www.abandon-pefrfection.com, www.abandon-pfrfection.com, www.abandon-pevrfection.com, www.abandon-pvrfection.com, www.abandon-pecrfection.com, www.abandon-pcrfection.com, www.abandon-peqrfection.com, www.abandon-pqrfection.com, www.abandon-pearfection.com, www.abandon-parfection.com, www.abandon-peyrfection.com, www.abandon-pyrfection.com,

Other websites we recently analyzed

  1. Aeroneb Medikamentenvernebler - INSPIRATION Medical GmbH
    INSPIRATION Medical präsentiert auf aeroneb.de Medikamentenvernebler. Aeroneb Go - Aeroneb Pro - Aeroneb Solo
    Germany - 217.160.36.196
    Server software: Apache
    Technology: CSS, Html, Javascript, Swf Object
    Number of Javascript: 4
    Number of meta tags: 8
  2. Willkommen auf der Homepage von
    Switzerland - 80.74.155.167
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  3. kalley-uk.net
    Switzerland - 141.8.225.31
    Server software: Apache
    Technology: Html
  4. Ansambel Neljapäev
    Neljapäev on eesti- ja ingliskeelset kergemat tantsulist rokkmuusikat viljelev ansambel.
    Estonia - 195.222.15.76
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, jQuery Colorbox, Php, Google Analytics, Facebook Like box
    Number of Javascript: 2
    Number of meta tags: 2
  5. 60 Sekunden Optionen
    60 Sekunden Optionen Tool gratis 30 Tage testen
    Germany - 85.13.140.187
    Server software: Apache
    Technology: CSS, Html, Javascript
    Number of meta tags: 25
  6. naxal.ru - Diese Website steht zum Verkauf! - Informationen zum Thema naxal.
    Diese Website steht zum Verkauf! naxal.ru ist Ihre erste und beste Informationsquelle über naxal Hier finden Sie auch weitere interessante Links. Wir hoffen, dass Sie bei Ihrer Suche erfolgreich sind!
    Germany - 82.98.86.169
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  7. 介護資格≪おすすめ求人≫
    今から介護資格を取りにいこうと思ってます。
    Osaka (Japan) - 112.78.200.16
    Server software: LiteSpeed
    Technology: CSS, Html
    Number of meta tags: 3
  8. Psychiatry Port Orange, Florida
    Psychiatrist, Psychiatry, Therapy, Counseling, Psychotherapy, Depression, Anxiety, ADHD, Obsessive Compulsive Disorder, Stress Management, OCD, PTSD
    Ashburn (United States) - 54.236.189.61
    G Analytics ID: UA-49148900-1
    Server software: openresty/1.7.4.1
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Google Analytics
    Number of Javascript: 10
    Number of meta tags: 4
  9. keechains.org
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. kellerwilliamsrealtyservices.com
    Chicago (United States) - 184.154.247.147
    Server software: nginx
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Wordpress
    Number of Javascript: 22
    Number of meta tags: 3

Check Other Websites